Lineage for d1m1jc1 (1m1j C:142-393)

  1. Root: SCOP 1.61
  2. 187024Class d: Alpha and beta proteins (a+b) [53931] (212 folds)
  3. 199038Fold d.171: Fibrinogen C-terminal domain-like [56495] (1 superfamily)
  4. 199039Superfamily d.171.1: Fibrinogen C-terminal domain-like [56496] (1 family) (S)
  5. 199040Family d.171.1.1: Fibrinogen C-terminal domain-like [56497] (2 proteins)
  6. 199041Protein Fibrinogen C-terminal domains [56498] (7 species)
  7. 199045Species Chicken (Gallus gallus), gamma [TaxId:9031] [69859] (1 PDB entry)
  8. 199046Domain d1m1jc1: 1m1j C:142-393 [74372]
    Other proteins in same PDB: d1m1ja1, d1m1jb2, d1m1jc2, d1m1jd1, d1m1je2, d1m1jf2

Details for d1m1jc1

PDB Entry: 1m1j (more details), 2.7 Å

PDB Description: crystal structure of native chicken fibrinogen with two different bound ligands

SCOP Domain Sequences for d1m1jc1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1m1jc1 d.171.1.1 (C:142-393) Fibrinogen C-terminal domains {Chicken (Gallus gallus), gamma}
taeiqettgrdcqdiankgarksglyfikpqkakqsflvyceidtygngwtvlqrrldgs
edfrrnwvqykegfghlspddttefwlgnekihlittqstlpyalrieledwsgkkgtad
yavfkvgteedkyrltyayfiggeagdafdgfnfgddpsdksytyhngmrfstfdndndn
fegncaeqdgsgwwmnrchaghlngpyyiggvysrdtgtnsydngiiwatwrdrwysmkk
ttmkiipfnrls

SCOP Domain Coordinates for d1m1jc1:

Click to download the PDB-style file with coordinates for d1m1jc1.
(The format of our PDB-style files is described here.)

Timeline for d1m1jc1: