Lineage for d1m1ja_ (1m1j A:)

  1. Root: SCOPe 2.07
  2. 2643820Class h: Coiled coil proteins [57942] (7 folds)
  3. 2643821Fold h.1: Parallel coiled-coil [57943] (41 superfamilies)
    this is not a true fold; includes oligomers of shorter identical helices
  4. 2644538Superfamily h.1.8: Fibrinogen coiled-coil and central regions [58010] (2 families) (S)
  5. 2644539Family h.1.8.1: Fibrinogen coiled-coil and central regions [58011] (3 proteins)
    in the central region two triple coiled-coils are stacked end-to-end and interlock with N-terminal tails
  6. 2644540Protein Fibrinogen alpha chain [88887] (4 species)
  7. 2644541Species Chicken (Gallus gallus) [TaxId:9031] [88888] (1 PDB entry)
  8. 2644542Domain d1m1ja_: 1m1j A: [74369]
    Other proteins in same PDB: d1m1jb1, d1m1jb2, d1m1jc1, d1m1jc2, d1m1je1, d1m1je2, d1m1jf1, d1m1jf2
    complexed with ca, nag, ndg

Details for d1m1ja_

PDB Entry: 1m1j (more details), 2.7 Å

PDB Description: crystal structure of native chicken fibrinogen with two different bound ligands
PDB Compounds: (A:) Fibrinogen alpha subunit

SCOPe Domain Sequences for d1m1ja_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1m1ja_ h.1.8.1 (A:) Fibrinogen alpha chain {Chicken (Gallus gallus) [TaxId: 9031]}
sckyeknwpicvdddwgtkcpsgcrmqgiiddtdqnysqridnirqqladsqnkyktsnr
vivetinilkpglegaqqldenyghvstelrrrivtlkqrvatqvnrikalqnsiqeqvv
emkrlevdidikirackgscarsfdyqvdkegydniqkhltqassidmhpdfqtttlstl
kmrplkdsnvpe

SCOPe Domain Coordinates for d1m1ja_:

Click to download the PDB-style file with coordinates for d1m1ja_.
(The format of our PDB-style files is described here.)

Timeline for d1m1ja_: