| Class i: Low resolution protein structures [58117] (22 folds) |
| Fold i.6: Viruses and virus-receptor complexes [58162] (1 superfamily) |
Superfamily i.6.1: Viruses and virus-receptor complexes [58163] (1 family) ![]() |
| Family i.6.1.1: Viruses and virus-receptor complexes [58164] (11 proteins) |
| Protein Decay-accelerating factor bound to echovirus 7 [75716] (1 species) |
| Species Human (Homo sapiens) and human echovirus 7 [TaxId:9606] [75717] (1 PDB entry) |
| Domain d1m113_: 1m11 3: [74365] |
PDB Entry: 1m11 (more details)
SCOP Domain Sequences for d1m113_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1m113_ i.6.1.1 (3:) Decay-accelerating factor bound to echovirus 7 {Human (Homo sapiens) and human echovirus 7}
gfpvlntpgsnqfmtsddfqspsampqfdvtphmdipgevhnlmeiaevdsvvpvnnikv
nlqsmdayhievntgnhqgekifafqmqpglesvfkrtlmgeilnyyahwsgsikltftf
cgsamatgklllaysppgadvpatrkqamlgthmiwdiglqsscvlcipwisqthyrlvq
qdeytsagnvtcwyqtgivvppgtpnkcvvlcfasacndfsvrmlrdtpfigqtallq
Timeline for d1m113_: