Lineage for d1m10b_ (1m10 B:)

  1. Root: SCOP 1.61
  2. 172677Class c: Alpha and beta proteins (a/b) [51349] (117 folds)
  3. 177029Fold c.10: Leucine-rich repeat, LRR (right-handed beta-alpha superhelix) [52046] (2 superfamilies)
  4. 177065Superfamily c.10.2: L domain-like [52058] (7 families) (S)
  5. 177117Family c.10.2.7: von Willebrand factor binding domain of glycoprotein Ib alpha [75142] (1 protein)
    this is a repeat family; one repeat unit is 1xwd C:97-122 found in domain
  6. 177118Protein von Willebrand factor binding domain of glycoprotein Ib alpha [75143] (1 species)
  7. 177119Species Human (Homo sapiens) [TaxId:9606] [75144] (2 PDB entries)
  8. 177122Domain d1m10b_: 1m10 B: [74362]
    Other proteins in same PDB: d1m10a_

Details for d1m10b_

PDB Entry: 1m10 (more details), 3.1 Å

PDB Description: crystal structure of the complex of glycoprotein ib alpha and the von willebrand factor a1 domain

SCOP Domain Sequences for d1m10b_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1m10b_ c.10.2.7 (B:) von Willebrand factor binding domain of glycoprotein Ib alpha {Human (Homo sapiens)}
hpicevskvashlevncdkrqltalppdlpkdttilhlsenllytfslatlmpytrltql
nldrceltklqvdgtlpvlgtldlshnqlqslpllgqtlpaltvldvsfnrltslplgal
rglgelqelylkgnelktlppglltptpkleklslannqltelpagllnglenldtlllq
enslytipkgffgshllpfaflhgnpwlcnceilyfrrwlqdnaenvyvwkqgvdvkavt
snvasvqcdnsdkfpvykypgkgcptl

SCOP Domain Coordinates for d1m10b_:

Click to download the PDB-style file with coordinates for d1m10b_.
(The format of our PDB-style files is described here.)

Timeline for d1m10b_:

View in 3D
Domains from other chains:
(mouse over for more information)
d1m10a_