SCOP 1.61: Domain d1m10b_: 1m10 B:

Lineage for d1m10b_ (1m10 B:)

1. Root: SCOP 1.61

2. Class c: Alpha and beta proteins (a/b) [51349] (117 folds)

3. Fold c.10: Leucine-rich repeat, LRR (right-handed beta-alpha superhelix) [52046] (2 superfamilies)

4. Superfamily c.10.2: L domain-like [52058] (7 families)

5. Family c.10.2.7: von Willebrand factor binding domain of glycoprotein Ib alpha [75142] (1 protein)
   this is a repeat family; one repeat unit is 1xwd C:97-122 found in domain

6. Protein von Willebrand factor binding domain of glycoprotein Ib alpha [75143] (1 species)

7. Species Human (Homo sapiens) [TaxId:9606] [75144] (2 PDB entries)

8. Domain d1m10b_: 1m10 B: [74362]
   Other proteins in same PDB: d1m10a_

Details for d1m10b_

PDB Entry: 1m10, 3.1 Å

PDB Description: crystal structure of the complex of glycoprotein ib alpha and the von willebrand factor a1 domain

SCOP Domain Sequences for d1m10b_:

Sequence; same for both SEQRES and ATOM records:

>d1m10b_ c.10.2.7 (B:) von Willebrand factor binding domain of glycoprotein Ib alpha {Human (Homo sapiens)}
hpicevskvashlevncdkrqltalppdlpkdttilhlsenllytfslatlmpytrltql
nldrceltklqvdgtlpvlgtldlshnqlqslpllgqtlpaltvldvsfnrltslplgal
rglgelqelylkgnelktlppglltptpkleklslannqltelpagllnglenldtlllq
enslytipkgffgshllpfaflhgnpwlcnceilyfrrwlqdnaenvyvwkqgvdvkavt
snvasvqcdnsdkfpvykypgkgcptl

Timeline for d1m10b_:

• d1m10b_ is new in SCOP 1.61
  
• d1m10b_ appears in SCOP 1.63
  
• d1m10b_ appears in the current release, SCOPe 2.08