SCOP 1.61: Domain d1m10a_: 1m10 A:

Lineage for d1m10a_ (1m10 A:)

1. Root: SCOP 1.61

2. Class c: Alpha and beta proteins (a/b) [51349] (117 folds)

3. Fold c.62: Integrin A (or I) domain [53299] (1 superfamily)

4. Superfamily c.62.1: Integrin A (or I) domain [53300] (1 family)

5. Family c.62.1.1: Integrin A (or I) domain [53301] (7 proteins)

6. Protein von Willebrand factor A1 domain [53306] (1 species)

7. Species Human (Homo sapiens) [TaxId:9606] [53307] (6 PDB entries)

8. Domain d1m10a_: 1m10 A: [74361]
   Other proteins in same PDB: d1m10b_

Details for d1m10a_

PDB Entry: 1m10, 3.1 Å

PDB Description: crystal structure of the complex of glycoprotein ib alpha and the von willebrand factor a1 domain

SCOP Domain Sequences for d1m10a_:

Sequence; same for both SEQRES and ATOM records:

>d1m10a_ c.62.1.1 (A:) von Willebrand factor A1 domain {Human (Homo sapiens)}
hdfycsrlldlvflldgssrlseaefevlkafvvdmmeqlrisqkwvrvavveyhdgsha
yiglkdrkrpselrriasqvkyagsqvastsevlkytlfqifskidrpeasrialllmas
qepqrmsrnfvryvqglkkkkvivipvgigphanlkqirliekqapenkafvlssvdele
qqrdeivsylcdlapeapp

Timeline for d1m10a_:

• d1m10a_ is new in SCOP 1.61
  
• d1m10a_ appears in SCOP 1.63
  
• d1m10a_ appears in the current release, SCOPe 2.08