Lineage for d1m0zb_ (1m0z B:)

  1. Root: SCOPe 2.06
  2. 2089713Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2111496Fold c.10: Leucine-rich repeat, LRR (right-handed beta-alpha superhelix) [52046] (3 superfamilies)
    2 curved layers, a/b; parallel beta-sheet; order 1234...N; there are sequence similarities between different superfamilies
  4. 2111565Superfamily c.10.2: L domain-like [52058] (9 families) (S)
    less regular structure consisting of variable repeats
  5. 2111716Family c.10.2.7: Ngr ectodomain-like [75142] (7 proteins)
    this is a repeat family; one repeat unit is 1xwd C:97-122 found in domain
  6. 2111738Protein von Willebrand factor binding domain of glycoprotein Ib alpha [75143] (1 species)
  7. 2111739Species Human (Homo sapiens) [TaxId:9606] [75144] (10 PDB entries)
  8. 2111742Domain d1m0zb_: 1m0z B: [74360]

Details for d1m0zb_

PDB Entry: 1m0z (more details), 1.85 Å

PDB Description: crystal structure of the von willebrand factor binding domain of glycoprotein ib alpha
PDB Compounds: (B:) Glycoprotein Ib alpha

SCOPe Domain Sequences for d1m0zb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1m0zb_ c.10.2.7 (B:) von Willebrand factor binding domain of glycoprotein Ib alpha {Human (Homo sapiens) [TaxId: 9606]}
hpicevskvashlevncdkrqltalppdlpkdttilhlsenllytfslatlmpytrltql
nldrceltklqvdgtlpvlgtldlshnqlqslpllgqtlpaltvldvsfnrltslplgal
rglgelqelylkgnelktlppglltptpkleklslannqltelpagllnglenldtlllq
enslytipkgffgshllpfaflhgnpwlcnceilyfrrwlqdnaenvyvwkqgvdvkamt
snvasvqcdnsdkfpvykypgkgcpt

SCOPe Domain Coordinates for d1m0zb_:

Click to download the PDB-style file with coordinates for d1m0zb_.
(The format of our PDB-style files is described here.)

Timeline for d1m0zb_:

View in 3D
Domains from other chains:
(mouse over for more information)
d1m0za_