![]() | Class c: Alpha and beta proteins (a/b) [51349] (121 folds) |
![]() | Fold c.10: Leucine-rich repeat, LRR (right-handed beta-alpha superhelix) [52046] (2 superfamilies) 2 curved layers, a/b; parallel beta-sheet; order 1234...N |
![]() | Superfamily c.10.2: L domain-like [52058] (8 families) ![]() less regular structure consisting of variable repeats |
![]() | Family c.10.2.7: Ngr ectodomain-like [75142] (2 proteins) this is a repeat family; one repeat unit is 1xwd C:97-122 found in domain |
![]() | Protein von Willebrand factor binding domain of glycoprotein Ib alpha [75143] (1 species) |
![]() | Species Human (Homo sapiens) [TaxId:9606] [75144] (6 PDB entries) |
![]() | Domain d1m0zb_: 1m0z B: [74360] mutant |
PDB Entry: 1m0z (more details), 1.85 Å
SCOP Domain Sequences for d1m0zb_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1m0zb_ c.10.2.7 (B:) von Willebrand factor binding domain of glycoprotein Ib alpha {Human (Homo sapiens)} hpicevskvashlevncdkrqltalppdlpkdttilhlsenllytfslatlmpytrltql nldrceltklqvdgtlpvlgtldlshnqlqslpllgqtlpaltvldvsfnrltslplgal rglgelqelylkgnelktlppglltptpkleklslannqltelpagllnglenldtlllq enslytipkgffgshllpfaflhgnpwlcnceilyfrrwlqdnaenvyvwkqgvdvkamt snvasvqcdnsdkfpvykypgkgcpt
Timeline for d1m0zb_: