| Class c: Alpha and beta proteins (a/b) [51349] (134 folds) |
| Fold c.52: Restriction endonuclease-like [52979] (3 superfamilies) core: 3 layers, a/b/a; mixed beta-sheet of 5 strands, order 12345; strands 2 &, in some families, 5 are antiparallel to the rest |
Superfamily c.52.1: Restriction endonuclease-like [52980] (30 families) ![]() |
| Family c.52.1.17: Endonuclease I (Holliday junction resolvase) [53029] (1 protein) |
| Protein Endonuclease I (Holliday junction resolvase) [53030] (1 species) forms dimer by swapping the common core elements |
| Species Bacteriophage T7 [TaxId:10760] [53031] (3 PDB entries) |
| Domain d1m0dd_: 1m0d D: [74357] complexed with mn, so4 |
PDB Entry: 1m0d (more details), 1.9 Å
SCOP Domain Sequences for d1m0dd_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1m0dd_ c.52.1.17 (D:) Endonuclease I (Holliday junction resolvase) {Bacteriophage T7}
sgledkvskqleskgikfeyeewkvpyvipasnhtytpdfllpngifvetkglwesddrk
khllireqhpeldirivfsssrtklykgsptsygefcekhgikfadklipaewikepkke
vpfdrlkrk
Timeline for d1m0dd_: