Lineage for d1m0dd_ (1m0d D:)

  1. Root: SCOP 1.67
  2. 383641Class c: Alpha and beta proteins (a/b) [51349] (130 folds)
  3. 397005Fold c.52: Restriction endonuclease-like [52979] (3 superfamilies)
    core: 3 layers, a/b/a; mixed beta-sheet of 5 strands, order 12345; strands 2 &, in some families, 5 are antiparallel to the rest
  4. 397006Superfamily c.52.1: Restriction endonuclease-like [52980] (22 families) (S)
  5. 397184Family c.52.1.17: Endonuclease I (Holliday junction resolvase) [53029] (1 protein)
  6. 397185Protein Endonuclease I (Holliday junction resolvase) [53030] (1 species)
    forms dimer by swapping the common core elements
  7. 397186Species Bacteriophage T7 [TaxId:10760] [53031] (3 PDB entries)
  8. 397194Domain d1m0dd_: 1m0d D: [74357]
    complexed with mn, so4

Details for d1m0dd_

PDB Entry: 1m0d (more details), 1.9 Å

PDB Description: Crystal Structure of Bacteriophage T7 Endonuclease I with a Wild-Type Active Site and Bound Manganese Ions

SCOP Domain Sequences for d1m0dd_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1m0dd_ c.52.1.17 (D:) Endonuclease I (Holliday junction resolvase) {Bacteriophage T7}
sgledkvskqleskgikfeyeewkvpyvipasnhtytpdfllpngifvetkglwesddrk
khllireqhpeldirivfsssrtklykgsptsygefcekhgikfadklipaewikepkke
vpfdrlkrk

SCOP Domain Coordinates for d1m0dd_:

Click to download the PDB-style file with coordinates for d1m0dd_.
(The format of our PDB-style files is described here.)

Timeline for d1m0dd_: