SCOPe 2.03: Domain d1m0dc_: 1m0d C:

Lineage for d1m0dc_ (1m0d C:)

1. Root: SCOPe 2.03

2. Class c: Alpha and beta proteins (a/b) [51349] (147 folds)

3. Fold c.52: Restriction endonuclease-like [52979] (4 superfamilies)
   core: 3 layers, a/b/a; mixed beta-sheet of 5 strands, order 12345; strands 2 &, in some families, 5 are antiparallel to the rest

4. Superfamily c.52.1: Restriction endonuclease-like [52980] (34 families)

5. Family c.52.1.17: Endonuclease I (Holliday junction resolvase) [53029] (1 protein)
   automatically mapped to Pfam PF05367

6. Protein Endonuclease I (Holliday junction resolvase) [53030] (1 species)
   forms dimer by swapping the common core elements

7. Species Bacteriophage T7 [TaxId:10760] [53031] (3 PDB entries)

8. Domain d1m0dc_: 1m0d C: [74356]
   complexed with mn, so4

Details for d1m0dc_

PDB Entry: 1m0d, 1.9 Å

PDB Description: Crystal Structure of Bacteriophage T7 Endonuclease I with a Wild-Type Active Site and Bound Manganese Ions

PDB Compounds: (C:) Endodeoxyribonuclease I

SCOPe Domain Sequences for d1m0dc_:

Sequence; same for both SEQRES and ATOM records:

>d1m0dc_ c.52.1.17 (C:) Endonuclease I (Holliday junction resolvase) {Bacteriophage T7 [TaxId: 10760]}
sgledkvskqleskgikfeyeewkvpyvipasnhtytpdfllpngifvetkglwesddrk
khllireqhpeldirivfsssrtklykgsptsygefcekhgikfadklipaewikepkke
vpfdrlkrk

Timeline for d1m0dc_:

• d1m0dc_ first appeared in SCOP 1.61
  
• d1m0dc_ appears in SCOPe 2.02
  
• d1m0dc_ appears in SCOPe 2.04
  
• d1m0dc_ appears in the current release, SCOPe 2.08