Lineage for d1lzja_ (1lzj A:)

  1. Root: SCOPe 2.06
  2. 2078559Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2133075Fold c.68: Nucleotide-diphospho-sugar transferases [53447] (1 superfamily)
    3 layers: a/b/a; mixed beta-sheet of 7 strands, order 3214657; strand 6 is antiparallel to the rest
  4. 2133076Superfamily c.68.1: Nucleotide-diphospho-sugar transferases [53448] (20 families) (S)
  5. 2133477Family c.68.1.9: alpha-1,3-galactosyltransferase-like [64131] (4 protein domains)
    automatically mapped to Pfam PF03414
  6. 2133579Protein Glycosyltransferase B [75278] (1 species)
    involved in blood group antigen biosynthesis
  7. 2133580Species Human (Homo sapiens) [TaxId:9606] [75279] (13 PDB entries)
  8. 2133581Domain d1lzja_: 1lzj A: [74352]
    complexed with hg, mn, udp

Details for d1lzja_

PDB Entry: 1lzj (more details), 1.32 Å

PDB Description: Glycosyltransferase B + UDP + H antigen acceptor
PDB Compounds: (A:) Glycosyltransferase B

SCOPe Domain Sequences for d1lzja_:

Sequence, based on SEQRES records: (download)

>d1lzja_ c.68.1.9 (A:) Glycosyltransferase B {Human (Homo sapiens) [TaxId: 9606]}
mvslprmvypqpkvltpcrkdvlvvtpwlapivwegtfnidilneqfrlqnttigltvfa
ikkyvaflklfletaekhfmvghrvhyyvftdqpaavprvtlgtgrqlsvlevgaykrwq
dvsmrrmemisdfcerrflsevdylvcvdvdmefrdhvgveiltplfgtlhpsfygssre
aftyerrpqsqayipkdegdfyymgaffggsvqevqrltrachqammvdqangieavwhd
eshlnkyllrhkptkvlspeylwdqqllgwpavlrklrftavp

Sequence, based on observed residues (ATOM records): (download)

>d1lzja_ c.68.1.9 (A:) Glycosyltransferase B {Human (Homo sapiens) [TaxId: 9606]}
mvslprmvypqpkvltpcrkdvlvvtpwlapivwegtfnidilneqfrlqnttigltvfa
ikkyvaflklfletaekhfmvghrvhyyvftdqpaavprvtlgtgrqlsvlevgerrfls
evdylvcvdvdmefrdhvgveiltplfgtlhpsfygssreaftyerrpqsqayipkdegd
fyymgaffggsvqevqrltrachqammvdqangieavwhdeshlnkyllrhkptkvlspe
ylwdqqllgwpavlrklrftavp

SCOPe Domain Coordinates for d1lzja_:

Click to download the PDB-style file with coordinates for d1lzja_.
(The format of our PDB-style files is described here.)

Timeline for d1lzja_: