SCOP 1.73: Domain d1lykb_: 1lyk B:

Lineage for d1lykb_ (1lyk B:)

1. Root: SCOP 1.73

2. Class a: All alpha proteins [46456] (258 folds)

3. Fold a.93: Heme-dependent peroxidases [48112] (1 superfamily)
   multihelical; consists of two all-alpha domains

4. Superfamily a.93.1: Heme-dependent peroxidases [48113] (3 families)

5. Family a.93.1.1: CCP-like [48114] (4 proteins)

6. Protein Fungal peroxidase (ligninase) [88935] (4 species)

7. Species Inky cap (Coprinus cinereus) [TaxId:5346] [74752] (5 PDB entries)

8. Domain d1lykb_: 1lyk B: [74347]
   complexed with ca, hem, man, mg, nag

Details for d1lykb_

PDB Entry: 1lyk, 2 Å

PDB Description: the impact of the physical and chemical enviroment on the molecular structure of coprinus cinereus peroxidase

PDB Compounds: (B:) Peroxidase

SCOP Domain Sequences for d1lykb_:

Sequence; same for both SEQRES and ATOM records:

>d1lykb_ a.93.1.1 (B:) Fungal peroxidase (ligninase) {Inky cap (Coprinus cinereus) [TaxId: 5346]}
svtcpggqstsnsqccvwfdvlddlqtnfyqgskcespvrkilrivfhdaigfspaltaa
gqfggggadgsiiahsnielafpanggltdtvealravginhgvsfgdliqfatavgmsn
cpgsprlefltgrsnssqpsppslipgpgntvtaildrmgdagfspdevvdllaahslas
qeglnsaifrspldstpqvfdtqfyietllkgttqpgpslgfaeelspfpgefrmrsdal
lardsrtacrwqsmtssnevmgqryraamakmsvlgfdrnaltdcsdvipsavsnnaapv
ipggltvddievscpsepfpeiatasgplpslapap

Timeline for d1lykb_:

• d1lykb_ first appeared in SCOP 1.61
  
• d1lykb_ appears in SCOP 1.71
  
• d1lykb_ appears in SCOP 1.75
  
• d1lykb_ appears in the current release, SCOPe 2.08