Lineage for d1lykb_ (1lyk B:)
- Root: SCOP 1.61
Class a: All alpha proteins [46456] (151 folds) 
Fold a.93: Heme-dependent peroxidases [48112] (1 superfamily) Superfamily a.93.1: Heme-dependent peroxidases [48113] (3 families) 
Family a.93.1.1: CCP-like [48114] (6 proteins) 
Protein Peroxidase [48117] (2 species) 
Species Inky cap (Coprinus cinereus) [TaxId:5346] [74752] (4 PDB entries) 
Domain d1lykb_: 1lyk B: [74347]
Details for d1lykb_
PDB Entry: 1lyk (more details), 2 Å
PDB Description: the impact of the physical and chemical enviroment on the molecular structure of coprinus cinereus peroxidase
SCOP Domain Sequences for d1lykb_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1lykb_ a.93.1.1 (B:) Peroxidase {Inky cap (Coprinus cinereus)}
svtcpggqstsnsqccvwfdvlddlqtnfyqgskcespvrkilrivfhdaigfspaltaa
gqfggggadgsiiahsnielafpanggltdtvealravginhgvsfgdliqfatavgmsn
cpgsprlefltgrsnssqpsppslipgpgntvtaildrmgdagfspdevvdllaahslas
qeglnsaifrspldstpqvfdtqfyietllkgttqpgpslgfaeelspfpgefrmrsdal
lardsrtacrwqsmtssnevmgqryraamakmsvlgfdrnaltdcsdvipsavsnnaapv
ipggltvddievscpsepfpeiatasgplpslapap
SCOP Domain Coordinates for d1lykb_:
Click to download the PDB-style file with coordinates for d1lykb_.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d1lykb_:
- d1lykb_ is new in SCOP 1.61
- d1lykb_ appears in SCOP 1.63
- d1lykb_ appears in the current release, SCOPe 2.08
View in 3D
