Lineage for d1lyka_ (1lyk A:)

  1. Root: SCOPe 2.07
  2. 2299346Class a: All alpha proteins [46456] (289 folds)
  3. 2328246Fold a.93: Heme-dependent peroxidases [48112] (1 superfamily)
    multihelical; consists of two all-alpha domains
  4. 2328247Superfamily a.93.1: Heme-dependent peroxidases [48113] (4 families) (S)
  5. 2328248Family a.93.1.1: CCP-like [48114] (5 protein domains)
  6. 2328491Protein Fungal peroxidase (ligninase) [88935] (3 species)
  7. 2328522Species Inky cap (Coprinus cinereus) [TaxId:5346] [74752] (5 PDB entries)
  8. 2328531Domain d1lyka_: 1lyk A: [74346]
    complexed with bma, ca, hem, man, mg, nag

Details for d1lyka_

PDB Entry: 1lyk (more details), 2 Å

PDB Description: the impact of the physical and chemical enviroment on the molecular structure of coprinus cinereus peroxidase
PDB Compounds: (A:) Peroxidase

SCOPe Domain Sequences for d1lyka_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1lyka_ a.93.1.1 (A:) Fungal peroxidase (ligninase) {Inky cap (Coprinus cinereus) [TaxId: 5346]}
svtcpggqstsnsqccvwfdvlddlqtnfyqgskcespvrkilrivfhdaigfspaltaa
gqfggggadgsiiahsnielafpanggltdtvealravginhgvsfgdliqfatavgmsn
cpgsprlefltgrsnssqpsppslipgpgntvtaildrmgdagfspdevvdllaahslas
qeglnsaifrspldstpqvfdtqfyietllkgttqpgpslgfaeelspfpgefrmrsdal
lardsrtacrwqsmtssnevmgqryraamakmsvlgfdrnaltdcsdvipsavsnnaapv
ipggltvddievscpsepfpeiatasgplpslapap

SCOPe Domain Coordinates for d1lyka_:

Click to download the PDB-style file with coordinates for d1lyka_.
(The format of our PDB-style files is described here.)

Timeline for d1lyka_: