Lineage for d1lycb_ (1lyc B:)

  1. Root: SCOP 1.75
  2. 758332Class a: All alpha proteins [46456] (284 folds)
  3. 773241Fold a.93: Heme-dependent peroxidases [48112] (1 superfamily)
    multihelical; consists of two all-alpha domains
  4. 773242Superfamily a.93.1: Heme-dependent peroxidases [48113] (3 families) (S)
  5. 773243Family a.93.1.1: CCP-like [48114] (4 proteins)
  6. 773392Protein Fungal peroxidase (ligninase) [88935] (4 species)
  7. 773416Species Inky cap (Coprinus cinereus) [TaxId:5346] [74752] (5 PDB entries)
  8. 773418Domain d1lycb_: 1lyc B: [74345]
    complexed with ca, hem

Details for d1lycb_

PDB Entry: 1lyc (more details), 1.57 Å

PDB Description: the impact of the physical and chemical enviroment on the molecular structure of coprinus cinereus peroxidase
PDB Compounds: (B:) Peroxidase

SCOP Domain Sequences for d1lycb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1lycb_ a.93.1.1 (B:) Fungal peroxidase (ligninase) {Inky cap (Coprinus cinereus) [TaxId: 5346]}
svtcpggqstsnsqccvwfdvlddlqtnfyqgskcespvrkilrivfhdaigfspaltaa
gqfggggadgsiiahsnielafpanggltdtvealravginhgvsfgdliqfatavgmsn
cpgsprlefltgrssssqpsppslipgpgntvtaildrmgdagfspdevvdllaahslas
qeglnsaifrspldstpqvfdtqfyietllkgttqpgpslgfaeelspfpgefrmrsdal
lardsrtacrwqsmtssnevmgqryraamakmsvlgfdrnaltdcsdvipsavsnnaapv
ipggltvddievscpsepfpeiaaasgplpalapap

SCOP Domain Coordinates for d1lycb_:

Click to download the PDB-style file with coordinates for d1lycb_.
(The format of our PDB-style files is described here.)

Timeline for d1lycb_: