Lineage for d1ly9b_ (1ly9 B:)

  1. Root: SCOP 1.73
  2. 631650Class a: All alpha proteins [46456] (258 folds)
  3. 644948Fold a.93: Heme-dependent peroxidases [48112] (1 superfamily)
    multihelical; consists of two all-alpha domains
  4. 644949Superfamily a.93.1: Heme-dependent peroxidases [48113] (3 families) (S)
  5. 644950Family a.93.1.1: CCP-like [48114] (4 proteins)
  6. 645087Protein Fungal peroxidase (ligninase) [88935] (4 species)
  7. 645111Species Inky cap (Coprinus cinereus) [TaxId:5346] [74752] (5 PDB entries)
  8. 645115Domain d1ly9b_: 1ly9 B: [74343]
    complexed with ca, hem

Details for d1ly9b_

PDB Entry: 1ly9 (more details), 2 Å

PDB Description: the impact of the physical and chemical environment on the molecular structure of coprinus cinereus peroxidase
PDB Compounds: (B:) Peroxidase

SCOP Domain Sequences for d1ly9b_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1ly9b_ a.93.1.1 (B:) Fungal peroxidase (ligninase) {Inky cap (Coprinus cinereus) [TaxId: 5346]}
svtcpggqstsnsqccvwfdvlddlqtnfyqgskcespvrkilrivfhdaigfspaltaa
gqfggggadgsiiahsnielafpanggltdtvealravginhgvsfgdliqfatavgmsn
cpgsprlefltgrssssqpsppslipgpgntvtaildrmgdagfspdevvdllaahslas
qeglnsaifrspldstpqvfdtqfyietllkgttqpgpslgfaeelspfpgefrmrsdal
lardsrtacrwqsmtssnevmgqryraamakmsvlgfdrnaltdcsdvipsavsnnaapv
ipggltvddievscpsepfpeiaaasgplpalapap

SCOP Domain Coordinates for d1ly9b_:

Click to download the PDB-style file with coordinates for d1ly9b_.
(The format of our PDB-style files is described here.)

Timeline for d1ly9b_: