SCOPe Funding Alert: SCOPe support from the NIH ended in April 2016. John-Marc Chandonia is the primary maintainer and has continued to develop SCOPe using vacation time. Three proposals to the NIH for continued funding have been unsuccessful. If our current NIH proposal is not funded, SCOPe will shut down permanently in Summer 2017 as Dr. Chandonia will need to seek a new position.

Lineage for d1ly8a_ (1ly8 A:)

  1. Root: SCOPe 2.06
  2. 1976409Class a: All alpha proteins [46456] (289 folds)
  3. 2002464Fold a.93: Heme-dependent peroxidases [48112] (1 superfamily)
    multihelical; consists of two all-alpha domains
  4. 2002465Superfamily a.93.1: Heme-dependent peroxidases [48113] (4 families) (S)
  5. 2002466Family a.93.1.1: CCP-like [48114] (5 protein domains)
  6. 2002679Protein Fungal peroxidase (ligninase) [88935] (3 species)
  7. 2002710Species Inky cap (Coprinus cinereus) [TaxId:5346] [74752] (5 PDB entries)
  8. 2002719Domain d1ly8a_: 1ly8 A: [74340]
    complexed with bma, ca, gol, hem, man, nag; mutant

Details for d1ly8a_

PDB Entry: 1ly8 (more details), 2.05 Å

PDB Description: The crystal structure of a mutant enzyme of Coprinus cinereus peroxidase provides an understanding of its increased thermostability and insight into modelling of protein structures
PDB Compounds: (A:) Peroxidase

SCOPe Domain Sequences for d1ly8a_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1ly8a_ a.93.1.1 (A:) Fungal peroxidase (ligninase) {Inky cap (Coprinus cinereus) [TaxId: 5346]}
gggsvtcpggqstsnsqccvwfdvlddlqtnfyqgskcespvrkslriafhdaigfspal
taagqfggggadgsiiahsnielafpanggltdtvealravginhgvsfgdliqfaaavg
msncpgsprlefltgrsnssqpsppslipgpgntvtaildrfgdagfspdevvdllaahs
lasqeglnsaifrspldstpqvfdtqfyietllkgttqpgpslgfaeelspfpggfrirs
dallardsrtacrwqsmtssnevmgqrfraamakmsvlgfdrnaltdcsdvipsavsnna
apvipggltvddievscpsepfpeiatasgplpslapap

SCOPe Domain Coordinates for d1ly8a_:

Click to download the PDB-style file with coordinates for d1ly8a_.
(The format of our PDB-style files is described here.)

Timeline for d1ly8a_: