Lineage for d1ly4a_ (1ly4 A:)

  1. Root: SCOP 1.75
  2. 814173Class c: Alpha and beta proteins (a/b) [51349] (147 folds)
  3. 843142Fold c.71: Dihydrofolate reductase-like [53596] (1 superfamily)
    3 layers: a/b/a; mixed beta-sheet of 8 strands, order 34251687; strand 8 is antiparallel to the rest
  4. 843143Superfamily c.71.1: Dihydrofolate reductase-like [53597] (2 families) (S)
  5. 843144Family c.71.1.1: Dihydrofolate reductases [53598] (3 proteins)
  6. 843259Protein Dihydrofolate reductases, eukaryotic type [53605] (4 species)
  7. 843269Species Fungus (Pneumocystis carinii) [TaxId:4754] [53608] (14 PDB entries)
  8. 843281Domain d1ly4a_: 1ly4 A: [74338]
    complexed with coq, nap

Details for d1ly4a_

PDB Entry: 1ly4 (more details), 2.1 Å

PDB Description: analysis of quinazoline and pyrido[2,3d]pyrimidine n9-c10 reversed bridge antifolates in complex with nadp+ and pneumocystis carinii dihydrofolate reductase
PDB Compounds: (A:) dihydrofolate reductase

SCOP Domain Sequences for d1ly4a_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1ly4a_ c.71.1.1 (A:) Dihydrofolate reductases, eukaryotic type {Fungus (Pneumocystis carinii) [TaxId: 4754]}
nqqksltlivalttsygigrsnslpwklkkeisyfkrvtsfvptfdsfesmnvvlmgrkt
wesiplqfrplkgrinvvitrnesldlgngihsaksldhalellyrtygsessvqinrif
viggaqlykaamdhpkldrimatiiykdihcdvffplkfrdkewssvwkkekhsdleswv
gtkvphgkinedgfdyefemwtrdl

SCOP Domain Coordinates for d1ly4a_:

Click to download the PDB-style file with coordinates for d1ly4a_.
(The format of our PDB-style files is described here.)

Timeline for d1ly4a_: