Class g: Small proteins [56992] (100 folds) |
Fold g.18: Complement control module/SCR domain [57534] (1 superfamily) disulfide-rich all-beta fold |
Superfamily g.18.1: Complement control module/SCR domain [57535] (2 families) |
Family g.18.1.1: Complement control module/SCR domain [57536] (15 proteins) Pfam PF00084 |
Protein Complement receptor 2, cr2 [64564] (1 species) |
Species Human (Homo sapiens) [TaxId:9606] [64565] (4 PDB entries) |
Domain d1ly2a2: 1ly2 A:67-128 [74336] Other proteins in same PDB: d1ly2a3, d1ly2a4 complexed with nag |
PDB Entry: 1ly2 (more details), 1.8 Å
SCOPe Domain Sequences for d1ly2a2:
Sequence; same for both SEQRES and ATOM records: (download)
>d1ly2a2 g.18.1.1 (A:67-128) Complement receptor 2, cr2 {Human (Homo sapiens) [TaxId: 9606]} kysscpepivpggykirgstpyrhgdsvtfacktnfsmngnksvwcqannmwgptrlptc vs
Timeline for d1ly2a2: