Lineage for d1ly2a2 (1ly2 A:67-128)

  1. Root: SCOPe 2.08
  2. 3029608Class g: Small proteins [56992] (100 folds)
  3. 3034014Fold g.18: Complement control module/SCR domain [57534] (1 superfamily)
    disulfide-rich all-beta fold
  4. 3034015Superfamily g.18.1: Complement control module/SCR domain [57535] (2 families) (S)
  5. 3034016Family g.18.1.1: Complement control module/SCR domain [57536] (15 proteins)
    Pfam PF00084
  6. 3034234Protein Complement receptor 2, cr2 [64564] (1 species)
  7. 3034235Species Human (Homo sapiens) [TaxId:9606] [64565] (4 PDB entries)
  8. 3034237Domain d1ly2a2: 1ly2 A:67-128 [74336]
    Other proteins in same PDB: d1ly2a3, d1ly2a4
    complexed with nag

Details for d1ly2a2

PDB Entry: 1ly2 (more details), 1.8 Å

PDB Description: crystal structure of unliganded human cd21 scr1-scr2 (complement receptor type 2)
PDB Compounds: (A:) complement receptor type 2

SCOPe Domain Sequences for d1ly2a2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1ly2a2 g.18.1.1 (A:67-128) Complement receptor 2, cr2 {Human (Homo sapiens) [TaxId: 9606]}
kysscpepivpggykirgstpyrhgdsvtfacktnfsmngnksvwcqannmwgptrlptc
vs

SCOPe Domain Coordinates for d1ly2a2:

Click to download the PDB-style file with coordinates for d1ly2a2.
(The format of our PDB-style files is described here.)

Timeline for d1ly2a2: