Lineage for d1ly2a1 (1ly2 A:0-66)

  1. Root: SCOP 1.71
  2. 621190Class g: Small proteins [56992] (79 folds)
  3. 623526Fold g.18: Complement control module/SCR domain [57534] (1 superfamily)
    disulfide-rich all-beta fold
  4. 623527Superfamily g.18.1: Complement control module/SCR domain [57535] (1 family) (S)
  5. 623528Family g.18.1.1: Complement control module/SCR domain [57536] (11 proteins)
    Pfam 00084
  6. 623695Protein Complement receptor 2, cr2 [64564] (1 species)
  7. 623696Species Human (Homo sapiens) [TaxId:9606] [64565] (2 PDB entries)
  8. 623697Domain d1ly2a1: 1ly2 A:0-66 [74335]

Details for d1ly2a1

PDB Entry: 1ly2 (more details), 1.8 Å

PDB Description: crystal structure of unliganded human cd21 scr1-scr2 (complement receptor type 2)

SCOP Domain Sequences for d1ly2a1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1ly2a1 g.18.1.1 (A:0-66) Complement receptor 2, cr2 {Human (Homo sapiens)}
eascgspppilngrisyystpiavgtviryscsgtfrligeksllcitkdkvdgtwdkpa
pkceyfn

SCOP Domain Coordinates for d1ly2a1:

Click to download the PDB-style file with coordinates for d1ly2a1.
(The format of our PDB-style files is described here.)

Timeline for d1ly2a1:

View in 3D
Domains from same chain:
(mouse over for more information)
d1ly2a2