Lineage for d1ly1a_ (1ly1 A:)

  1. Root: SCOP 1.61
  2. 172677Class c: Alpha and beta proteins (a/b) [51349] (117 folds)
  3. 179162Fold c.37: P-loop containing nucleotide triphosphate hydrolases [52539] (1 superfamily)
  4. 179163Superfamily c.37.1: P-loop containing nucleotide triphosphate hydrolases [52540] (18 families) (S)
  5. 179164Family c.37.1.1: Nucleotide and nucleoside kinases [52541] (15 proteins)
  6. 179257Protein Polynucleotide kinase, kinase domain [75191] (1 species)
  7. 179258Species Bacteriophage T4 [TaxId:10665] [75192] (1 PDB entry)
  8. 179259Domain d1ly1a_: 1ly1 A: [74334]

Details for d1ly1a_

PDB Entry: 1ly1 (more details), 2 Å

PDB Description: Structure and Mechanism of T4 Polynucleotide Kinase
PDB Compounds: (A:)

SCOP Domain Sequences for d1ly1a_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1ly1a_ c.37.1.1 (A:) Polynucleotide kinase, kinase domain {Bacteriophage T4}
mkkiiltigcpgsgkstwarefiaknpgfyninrddyrqsimaheerdeykytkkkegiv
tgmqfdtaksilyggdsvkgviisdtnlnperrlawetfakeygwkvehkvfdvpwtelv
krnskrgtkavpidvlrsmyksmreylglpvy

SCOP Domain Coordinates for d1ly1a_:

Click to download the PDB-style file with coordinates for d1ly1a_.
(The format of our PDB-style files is described here.)

Timeline for d1ly1a_: