Lineage for d1ly1a_ (1ly1 A:)
- Root: SCOP 1.61
Class c: Alpha and beta proteins (a/b) [51349] (117 folds) 
Fold c.37: P-loop containing nucleotide triphosphate hydrolases [52539] (1 superfamily) Superfamily c.37.1: P-loop containing nucleotide triphosphate hydrolases [52540] (18 families) 
Family c.37.1.1: Nucleotide and nucleoside kinases [52541] (15 proteins) 
Protein Polynucleotide kinase, kinase domain [75191] (1 species) Species Bacteriophage T4 [TaxId:10665] [75192] (1 PDB entry) 
Domain d1ly1a_: 1ly1 A: [74334]
Details for d1ly1a_
PDB Entry: 1ly1 (more details), 2 Å
PDB Description: Structure and Mechanism of T4 Polynucleotide Kinase
PDB Compounds: (A:) SCOP Domain Sequences for d1ly1a_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1ly1a_ c.37.1.1 (A:) Polynucleotide kinase, kinase domain {Bacteriophage T4}
mkkiiltigcpgsgkstwarefiaknpgfyninrddyrqsimaheerdeykytkkkegiv
tgmqfdtaksilyggdsvkgviisdtnlnperrlawetfakeygwkvehkvfdvpwtelv
krnskrgtkavpidvlrsmyksmreylglpvy
SCOP Domain Coordinates for d1ly1a_:
Click to download the PDB-style file with coordinates for d1ly1a_.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d1ly1a_:
- d1ly1a_ appears in SCOP 1.63
- d1ly1a_ appears in the current release, SCOPe 2.07
View in 3D