Lineage for d1lxka2 (1lxk A:815-889)

  1. Root: SCOP 1.61
  2. 157351Class b: All beta proteins [48724] (111 folds)
  3. 164390Fold b.24: Hyaluronate lyase-like, C-terminal domain [49862] (1 superfamily)
  4. 164391Superfamily b.24.1: Hyaluronate lyase-like, C-terminal domain [49863] (1 family) (S)
  5. 164392Family b.24.1.1: Hyaluronate lyase-like, C-terminal domain [49864] (2 proteins)
  6. 164400Protein Hyaluronate lyase [49867] (2 species)
  7. 164404Species Streptococcus pneumoniae [TaxId:1313] [49868] (5 PDB entries)
  8. 164405Domain d1lxka2: 1lxk A:815-889 [74332]
    Other proteins in same PDB: d1lxka1, d1lxka3

Details for d1lxka2

PDB Entry: 1lxk (more details), 1.53 Å

PDB Description: streptococcus pneumoniae hyaluronate lyase in complex with tetrasaccharide hyaluronan substrate

SCOP Domain Sequences for d1lxka2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1lxka2 b.24.1.1 (A:815-889) Hyaluronate lyase {Streptococcus pneumoniae}
ssliennetlqsvydakqgvwgivkyddsvstisnqfqvlkrgvytirkegdeykiayyn
petqesapdqevfkk

SCOP Domain Coordinates for d1lxka2:

Click to download the PDB-style file with coordinates for d1lxka2.
(The format of our PDB-style files is described here.)

Timeline for d1lxka2: