SCOP 1.69: Domain d1lx7b_: 1lx7 B:

Lineage for d1lx7b_ (1lx7 B:)

1. Root: SCOP 1.69

2. Class c: Alpha and beta proteins (a/b) [51349] (136 folds)

3. Fold c.56: Phosphorylase/hydrolase-like [53162] (6 superfamilies)
   core: 3 layers, a/b/a ; mixed sheet of 5 strands: order 21354; strand 4 is antiparallel to the rest; contains crossover loops

4. Superfamily c.56.2: Purine and uridine phosphorylases [53167] (1 family)
   complex architecture; contains mixed beta-sheet of 8 strands, order 23415867, strands 3, 6 & 7 are antiparallel to the rest; and barrel, closed; n=5, S=8

5. Family c.56.2.1: Purine and uridine phosphorylases [53168] (6 proteins)

6. Protein Uridine phosphorylase [53176] (1 species)

7. Species Escherichia coli [TaxId:562] [53177] (6 PDB entries)
   also includes the PDB entry (1rxs) where protein chains are designated by both upper case and lower case letters creating problems with its processing and presentation in SCOP

8. Domain d1lx7b_: 1lx7 B: [74330]

Details for d1lx7b_

PDB Entry: 1lx7, 2 Å

PDB Description: structure of e. coli uridine phosphorylase at 2.0a

SCOP Domain Sequences for d1lx7b_:

Sequence, based on SEQRES records:

>d1lx7b_ c.56.2.1 (B:) Uridine phosphorylase {Escherichia coli}
ksdvfhlgltkndlqgatlaivpgdpdrvekiaalmdkpvklashrefttwraeldgkpv
ivcstgiggpstsiaveelaqlgirtflrigttgaiqphinvgdvlvttasvrldgaslh
faplefpavadfecttalveaaksigatthvgvtassdtfypgqerydtysgrvvrhfkg
smeewqamgvmnyemesatlltmcasqglragmvagvivnrtqqeipnaetmkqteshav
kivveaarrll

Sequence, based on observed residues (ATOM records):

>d1lx7b_ c.56.2.1 (B:) Uridine phosphorylase {Escherichia coli}
ksdvfhlgltkndlqgatlaivpgdpdrvekiaalmdkpvklashrefttwraeldgkpv
ivcstgiggpstsiaveelaqlgirtflrigttgaiqphinvgdvlvttasvrldgaslh
faplefpavadfecttalveaaksigatthvgvtassdtfsmeewqamgvmnyemesatl
ltmcasqglragmvagvivntmkqteshavkivveaarrll

Timeline for d1lx7b_:

• d1lx7b_ first appeared in SCOP 1.61
  
• d1lx7b_ appears in SCOP 1.67
  
• d1lx7b_ appears in SCOP 1.71
  
• d1lx7b_ appears in the current release, SCOPe 2.08