SCOP 1.75: Domain d1lx7a_: 1lx7 A:

Lineage for d1lx7a_ (1lx7 A:)

1. Root: SCOP 1.75

2. Class c: Alpha and beta proteins (a/b) [51349] (147 folds)

3. Fold c.56: Phosphorylase/hydrolase-like [53162] (8 superfamilies)
   core: 3 layers, a/b/a ; mixed sheet of 5 strands: order 21354; strand 4 is antiparallel to the rest; contains crossover loops

4. Superfamily c.56.2: Purine and uridine phosphorylases [53167] (1 family)
   complex architecture; contains mixed beta-sheet of 8 strands, order 23415867, strands 3, 6 & 7 are antiparallel to the rest; and barrel, closed; n=5, S=8

5. Family c.56.2.1: Purine and uridine phosphorylases [53168] (6 proteins)

6. Protein Uridine phosphorylase [53176] (2 species)

7. Species Escherichia coli [TaxId:562] [53177] (13 PDB entries)
   also includes the PDB entry (1rxs) where protein chains are designated by both upper case and lower case letters creating problems with its processing and presentation in SCOP
   also includes the PDB entry (1rxs) where protein chains are designated by both upper case and lower case letters creating problems with its processing and presentation in SCOP

8. Domain d1lx7a_: 1lx7 A: [74329]

Details for d1lx7a_

PDB Entry: 1lx7, 2 Å

PDB Description: structure of e. coli uridine phosphorylase at 2.0a

PDB Compounds: (A:) Uridine phosphorylase

SCOP Domain Sequences for d1lx7a_:

Sequence; same for both SEQRES and ATOM records:

>d1lx7a_ c.56.2.1 (A:) Uridine phosphorylase {Escherichia coli [TaxId: 562]}
sdvfhlgltkndlqgatlaivpgdpdrvekiaalmdkpvklashrefttwraeldgkpvi
vcstgiggpstsiaveelaqlgirtflrigttgaiqphinvgdvlvttasvrldgaslhf
aplefpavadfecttalveaaksigatthvgvtassdtfypgqerydtysgrvvrhfkgs
meewqamgvmnyemesatlltmcasqglragmvagvivnrtqqeipnaetmkqteshavk
ivveaarrll

Timeline for d1lx7a_:

• d1lx7a_ first appeared in SCOP 1.61
  
• d1lx7a_ appears in SCOP 1.73
  
• d1lx7a_ appears in SCOPe 2.01
  
• d1lx7a_ appears in the current release, SCOPe 2.08