SCOPe 2.07: Domain d1lwuc2: 1lwu C:83-137

Lineage for d1lwuc2 (1lwu C:83-137)

1. Root: SCOPe 2.07

2. Class h: Coiled coil proteins [57942] (7 folds)

3. Fold h.1: Parallel coiled-coil [57943] (41 superfamilies)
   this is not a true fold; includes oligomers of shorter identical helices

4. Superfamily h.1.8: Fibrinogen coiled-coil and central regions [58010] (2 families)

5. Family h.1.8.1: Fibrinogen coiled-coil and central regions [58011] (3 proteins)
   in the central region two triple coiled-coils are stacked end-to-end and interlock with N-terminal tails

6. Protein Fibrinogen gamma chain [88898] (4 species)

7. Species Sea lamprey (Petromyzon marinus) [TaxId:7757] [88902] (2 PDB entries)

8. Domain d1lwuc2: 1lwu C:83-137 [74313]
   Other proteins in same PDB: d1lwua_, d1lwub1, d1lwub2, d1lwuc1, d1lwud_, d1lwue1, d1lwue2, d1lwuf1, d1lwug_, d1lwuh1, d1lwuh2, d1lwui1, d1lwuj_, d1lwuk1, d1lwuk2, d1lwul1
   coiled-coil region only
   complexed with bma, ca, gal, man, nag, ndg, nh2

Details for d1lwuc2

PDB Entry: 1lwu, 2.8 Å

PDB Description: crystal structure of fragment d from lamprey fibrinogen complexed with the peptide gly-his-arg-pro-amide

PDB Compounds: (C:) Fibrinogen gamma chain

SCOPe Domain Sequences for d1lwuc2:

Sequence; same for both SEQRES and ATOM records:

>d1lwuc2 h.1.8.1 (C:83-137) Fibrinogen gamma chain {Sea lamprey (Petromyzon marinus) [TaxId: 7757]}
ktvqkileevrileqigvshdaqiqelsemwrvnqqfvtrlqqqlvdirqtcsrp

Timeline for d1lwuc2:

• d1lwuc2 first appeared in SCOP 1.61
  
• d1lwuc2 appears in SCOPe 2.06
  
• d1lwuc2 appears in the current release, SCOPe 2.08