Class h: Coiled coil proteins [57942] (7 folds) |
Fold h.1: Parallel coiled-coil [57943] (41 superfamilies) this is not a true fold; includes oligomers of shorter identical helices |
Superfamily h.1.8: Fibrinogen coiled-coil and central regions [58010] (2 families) |
Family h.1.8.1: Fibrinogen coiled-coil and central regions [58011] (3 proteins) in the central region two triple coiled-coils are stacked end-to-end and interlock with N-terminal tails |
Protein Fibrinogen gamma chain [88898] (4 species) |
Species Sea lamprey (Petromyzon marinus) [TaxId:7757] [88902] (2 PDB entries) |
Domain d1lwuc2: 1lwu C:83-137 [74313] Other proteins in same PDB: d1lwua_, d1lwub1, d1lwub2, d1lwuc1, d1lwud_, d1lwue1, d1lwue2, d1lwuf1, d1lwug_, d1lwuh1, d1lwuh2, d1lwui1, d1lwuj_, d1lwuk1, d1lwuk2, d1lwul1 coiled-coil region only complexed with bma, ca, gal, man, nag, ndg, nh2 |
PDB Entry: 1lwu (more details), 2.8 Å
SCOPe Domain Sequences for d1lwuc2:
Sequence; same for both SEQRES and ATOM records: (download)
>d1lwuc2 h.1.8.1 (C:83-137) Fibrinogen gamma chain {Sea lamprey (Petromyzon marinus) [TaxId: 7757]} ktvqkileevrileqigvshdaqiqelsemwrvnqqfvtrlqqqlvdirqtcsrp
Timeline for d1lwuc2: