Lineage for d1lwuc2 (1lwu C:83-137)

  1. Root: SCOPe 2.08
  2. 3039230Class h: Coiled coil proteins [57942] (7 folds)
  3. 3039231Fold h.1: Parallel coiled-coil [57943] (41 superfamilies)
    this is not a true fold; includes oligomers of shorter identical helices
  4. 3039948Superfamily h.1.8: Fibrinogen coiled-coil and central regions [58010] (2 families) (S)
  5. 3039949Family h.1.8.1: Fibrinogen coiled-coil and central regions [58011] (3 proteins)
    in the central region two triple coiled-coils are stacked end-to-end and interlock with N-terminal tails
  6. 3040061Protein Fibrinogen gamma chain [88898] (4 species)
  7. 3040104Species Sea lamprey (Petromyzon marinus) [TaxId:7757] [88902] (2 PDB entries)
  8. 3040107Domain d1lwuc2: 1lwu C:83-137 [74313]
    Other proteins in same PDB: d1lwua_, d1lwub1, d1lwub2, d1lwuc1, d1lwud_, d1lwue1, d1lwue2, d1lwuf1, d1lwug_, d1lwuh1, d1lwuh2, d1lwui1, d1lwuj_, d1lwuk1, d1lwuk2, d1lwul1
    coiled-coil region only
    complexed with bma, ca, gal, man, nag, ndg, nh2

Details for d1lwuc2

PDB Entry: 1lwu (more details), 2.8 Å

PDB Description: crystal structure of fragment d from lamprey fibrinogen complexed with the peptide gly-his-arg-pro-amide
PDB Compounds: (C:) Fibrinogen gamma chain

SCOPe Domain Sequences for d1lwuc2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1lwuc2 h.1.8.1 (C:83-137) Fibrinogen gamma chain {Sea lamprey (Petromyzon marinus) [TaxId: 7757]}
ktvqkileevrileqigvshdaqiqelsemwrvnqqfvtrlqqqlvdirqtcsrp

SCOPe Domain Coordinates for d1lwuc2:

Click to download the PDB-style file with coordinates for d1lwuc2.
(The format of our PDB-style files is described here.)

Timeline for d1lwuc2: