SCOPe 2.08: Domain d1lwja2: 1lwj A:1-391

Lineage for d1lwja2 (1lwj A:1-391)

1. Root: SCOPe 2.08

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.1: TIM beta/alpha-barrel [51350] (34 superfamilies)
   contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
   the first seven superfamilies have similar phosphate-binding sites

4. Superfamily c.1.8: (Trans)glycosidases [51445] (15 families)

5. Family c.1.8.1: Amylase, catalytic domain [51446] (26 proteins)
   members of the family may contain various insert subdomains
   in alpha-amylases and closer relatives this domain is usually followed by a common all-beta domain

6. Protein 4-alpha-glucanotransferase [75062] (1 species)

7. Species Thermotoga maritima [TaxId:2336] [75063] (2 PDB entries)

8. Domain d1lwja2: 1lwj A:1-391 [74304]
   Other proteins in same PDB: d1lwja1, d1lwjb1
   complexed with acg, ca

Details for d1lwja2

PDB Entry: 1lwj, 2.5 Å

PDB Description: crystal structure of t. maritima 4-alpha-glucanotransferase/acarbose complex

PDB Compounds: (A:) 4-alpha-glucanotransferase

SCOPe Domain Sequences for d1lwja2:

Sequence; same for both SEQRES and ATOM records:

>d1lwja2 c.1.8.1 (A:1-391) 4-alpha-glucanotransferase {Thermotoga maritima [TaxId: 2336]}
migyqiyvrsfrdgnldgvgdfrglknavsylkelgidfvwlmpvfssisfhgydvvdfy
sfkaeygserefkemieafhdsgikvvldlpihhtgflhtwfqkalkgdphyrdyyvwan
ketdlderrewdgekiwhpledgrfyrglfgpfspdlnydnpqvfdemkrlvlhlldmgv
dgfrfdaakhmrdtieqnvrfwkyflsdlkgiflaeiwaearmvdehgrifgymlnfdts
hcikeavwkentrvliesieraviakdylpvnftsnhdmsrlasfeggfskekiklsisi
lftlpgvplvfygdelgmkgvyqkpntevvldpfpwnesmcvegqtfwkwpayngpfsgi
sveyqkrdpdsilshtlgwtrfrkenqwidr

Timeline for d1lwja2:

• d1lwja2 first appeared in SCOP 1.61
  
• d1lwja2 appears in SCOPe 2.07