Class b: All beta proteins [48724] (174 folds) |
Fold b.71: Glycosyl hydrolase domain [51010] (1 superfamily) folded sheet; greek-key |
Superfamily b.71.1: Glycosyl hydrolase domain [51011] (5 families) this domain is C-terminal to the catalytic beta/alpha barrel domain |
Family b.71.1.1: alpha-Amylases, C-terminal beta-sheet domain [51012] (22 proteins) this domain follows the catalytic beta/alpha barrel domain |
Protein 4-alpha-glucanotransferase [75018] (1 species) |
Species Thermotoga maritima [TaxId:2336] [75019] (2 PDB entries) |
Domain d1lwja1: 1lwj A:392-441 [74303] Other proteins in same PDB: d1lwja2, d1lwjb2 |
PDB Entry: 1lwj (more details), 2.5 Å
SCOP Domain Sequences for d1lwja1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1lwja1 b.71.1.1 (A:392-441) 4-alpha-glucanotransferase {Thermotoga maritima [TaxId: 2336]} akleflckedkflvyrlyddqhslkvfhnlsgeevvfegvkmkpyktevv
Timeline for d1lwja1: