SCOPe 2.05: Domain d1lwha1: 1lwh A:392-441

Lineage for d1lwha1 (1lwh A:392-441)

1. Root: SCOPe 2.05

2. Class b: All beta proteins [48724] (176 folds)

3. Fold b.71: Glycosyl hydrolase domain [51010] (1 superfamily)
   folded sheet; greek-key

4. Superfamily b.71.1: Glycosyl hydrolase domain [51011] (6 families)
   this domain is C-terminal to the catalytic beta/alpha barrel domain

5. Family b.71.1.1: alpha-Amylases, C-terminal beta-sheet domain [51012] (22 proteins)
   this domain follows the catalytic beta/alpha barrel domain

6. Protein 4-alpha-glucanotransferase [75018] (1 species)

7. Species Thermotoga maritima [TaxId:2336] [75019] (2 PDB entries)

8. Domain d1lwha1: 1lwh A:392-441 [74299]
   Other proteins in same PDB: d1lwha2, d1lwhb2
   complexed with ca

Details for d1lwha1

PDB Entry: 1lwh, 2.6 Å

PDB Description: crystal structure of t. maritima 4-alpha-glucanotransferase

PDB Compounds: (A:) 4-alpha-glucanotransferase

SCOPe Domain Sequences for d1lwha1:

Sequence; same for both SEQRES and ATOM records:

>d1lwha1 b.71.1.1 (A:392-441) 4-alpha-glucanotransferase {Thermotoga maritima [TaxId: 2336]}
akleflckedkflvyrlyddqhslkvfhnlsgeevvfegvkmkpyktevv

Timeline for d1lwha1:

• d1lwha1 first appeared in SCOP 1.61
  
• d1lwha1 appears in SCOPe 2.04
  
• d1lwha1 appears in SCOPe 2.06
  
• d1lwha1 appears in the current release, SCOPe 2.08