Lineage for d1lwha1 (1lwh A:392-441)

  1. Root: SCOPe 2.07
  2. 2344607Class b: All beta proteins [48724] (178 folds)
  3. 2400339Fold b.71: Glycosyl hydrolase domain [51010] (1 superfamily)
    folded sheet; greek-key
  4. 2400340Superfamily b.71.1: Glycosyl hydrolase domain [51011] (6 families) (S)
    this domain is C-terminal to the catalytic beta/alpha barrel domain
  5. 2400341Family b.71.1.1: alpha-Amylases, C-terminal beta-sheet domain [51012] (22 protein domains)
    this domain follows the catalytic beta/alpha barrel domain
  6. 2400348Protein 4-alpha-glucanotransferase [75018] (1 species)
  7. 2400349Species Thermotoga maritima [TaxId:2336] [75019] (2 PDB entries)
  8. 2400350Domain d1lwha1: 1lwh A:392-441 [74299]
    Other proteins in same PDB: d1lwha2, d1lwhb2
    complexed with ca

Details for d1lwha1

PDB Entry: 1lwh (more details), 2.6 Å

PDB Description: crystal structure of t. maritima 4-alpha-glucanotransferase
PDB Compounds: (A:) 4-alpha-glucanotransferase

SCOPe Domain Sequences for d1lwha1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1lwha1 b.71.1.1 (A:392-441) 4-alpha-glucanotransferase {Thermotoga maritima [TaxId: 2336]}
akleflckedkflvyrlyddqhslkvfhnlsgeevvfegvkmkpyktevv

SCOPe Domain Coordinates for d1lwha1:

Click to download the PDB-style file with coordinates for d1lwha1.
(The format of our PDB-style files is described here.)

Timeline for d1lwha1:

View in 3D
Domains from same chain:
(mouse over for more information)
d1lwha2