Lineage for d1lw7a2 (1lw7 A:220-411)

  1. Root: SCOPe 2.06
  2. 2078559Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2109203Fold c.37: P-loop containing nucleoside triphosphate hydrolases [52539] (1 superfamily)
    3 layers: a/b/a, parallel or mixed beta-sheets of variable sizes
  4. 2109204Superfamily c.37.1: P-loop containing nucleoside triphosphate hydrolases [52540] (26 families) (S)
    division into families based on beta-sheet topologies
  5. 2109205Family c.37.1.1: Nucleotide and nucleoside kinases [52541] (21 protein domains)
    parallel beta-sheet of 5 strands, order 23145
  6. 2109721Protein Transcriptional regulator NadR, ribosylnicotinamide kinase domain [75189] (1 species)
  7. 2109722Species Haemophilus influenzae [TaxId:727] [75190] (1 PDB entry)
  8. 2109723Domain d1lw7a2: 1lw7 A:220-411 [74296]
    Other proteins in same PDB: d1lw7a1
    complexed with nad, so4

Details for d1lw7a2

PDB Entry: 1lw7 (more details), 2.9 Å

PDB Description: nadr protein from haemophilus influenzae
PDB Compounds: (A:) transcriptional regulator nadr

SCOPe Domain Sequences for d1lw7a2:

Sequence, based on SEQRES records: (download)

>d1lw7a2 c.37.1.1 (A:220-411) Transcriptional regulator NadR, ribosylnicotinamide kinase domain {Haemophilus influenzae [TaxId: 727]}
earpffaktvailggessgksvlvnklaavfnttsaweygrefvfeklggdeqamqysdy
pqmalghqryidyavrhshkiafidtdfittqafciqyegkahpfldsmikeypfdvtil
lknntewvddglrslgsqkqrqqfqqllkklldkykvpyieiespsyldrynqvkaviek
vlneeeiselqn

Sequence, based on observed residues (ATOM records): (download)

>d1lw7a2 c.37.1.1 (A:220-411) Transcriptional regulator NadR, ribosylnicotinamide kinase domain {Haemophilus influenzae [TaxId: 727]}
earpffaktvailggessgksvlvnklaavfnttsaweygrefvfeklggdeqamqysdy
pqmalghqryidyavrhshkiafidtdfittqafciqyegkahpfldsmikeypfdvtil
lknnteqkqrqqfqqllkklldkykvpyieiespsyldrynqvkaviekvlneeeiselq
n

SCOPe Domain Coordinates for d1lw7a2:

Click to download the PDB-style file with coordinates for d1lw7a2.
(The format of our PDB-style files is described here.)

Timeline for d1lw7a2:

View in 3D
Domains from same chain:
(mouse over for more information)
d1lw7a1