SCOPe 2.06: Domain d1lw1b_: 1lw1 B:

Lineage for d1lw1b_ (1lw1 B:)

1. Root: SCOPe 2.06

2. Class a: All alpha proteins [46456] (289 folds)

3. Fold a.152: AhpD-like [69117] (1 superfamily)
   multihelical; contains 4-helical bundle and 2-helical arm

4. Superfamily a.152.1: AhpD-like [69118] (4 families)
   probable biological unit contains six domains of this fold arranged with 32 symmetry

5. Family a.152.1.1: AhpD [69119] (2 proteins)
   duplication: two-domain subunits form a helix-swapped trimer

6. Protein Antioxidant defense protein AhpD [69120] (1 species)
   a novel enzyme with thioredoxin-like activity

7. Species Mycobacterium tuberculosis [TaxId:1773] [69121] (4 PDB entries)

8. Domain d1lw1b_: 1lw1 B: [74291]
   mutant

Details for d1lw1b_

PDB Entry: 1lw1, 2.3 Å

PDB Description: crystal structure of mycobacterium tuberculosis alkylperoxidase ahpd h137f mutant

PDB Compounds: (B:) alkylhydroperoxidase d

SCOPe Domain Sequences for d1lw1b_:

Sequence; same for both SEQRES and ATOM records:

>d1lw1b_ a.152.1.1 (B:) Antioxidant defense protein AhpD {Mycobacterium tuberculosis [TaxId: 1773]}
ieklkaalpeyakdiklnlssitrssvldqeqlwgtllasaaatrnpqvladigaeatdh
lsaaarhaalgaaaimgmnnvfyrgrgflegryddlrpglrmniianpgipkanfelwsf
avsaingcshclvafehtlrtvgvdreaifealkaaaivsgvaqalatieals

Timeline for d1lw1b_:

• d1lw1b_ first appeared in SCOP 1.61
  
• d1lw1b_ appears in SCOPe 2.05
  
• d1lw1b_ appears in SCOPe 2.07
  
• d1lw1b_ appears in the current release, SCOPe 2.08