Lineage for d1lw1a_ (1lw1 A:)
- Root: SCOP 1.61
Class a: All alpha proteins [46456] (151 folds) 
Fold a.152: Antioxidant defence protein AhpD [69117] (1 superfamily) Superfamily a.152.1: Antioxidant defence protein AhpD [69118] (1 family) 
Family a.152.1.1: Antioxidant defence protein AhpD [69119] (1 protein) Protein Antioxidant defence protein AhpD [69120] (1 species) Species Mycobacterium tuberculosis [TaxId:1773] [69121] (3 PDB entries) 
Domain d1lw1a_: 1lw1 A: [74290]
Details for d1lw1a_
PDB Entry: 1lw1 (more details), 2.3 Å
PDB Description: crystal structure of mycobacterium tuberculosis alkylperoxidase ahpd h137f mutant
SCOP Domain Sequences for d1lw1a_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1lw1a_ a.152.1.1 (A:) Antioxidant defence protein AhpD {Mycobacterium tuberculosis}
ieklkaalpeyakdiklnlssitrssvldqeqlwgtllasaaatrnpqvladigaeatdh
lsaaarhaalgaaaimgmnnvfyrgrgflegryddlrpglrmniianpgipkanfelwsf
avsaingcshclvafehtlrtvgvdreaifealkaaaivsgvaqalatiealsps
SCOP Domain Coordinates for d1lw1a_:
Click to download the PDB-style file with coordinates for d1lw1a_.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d1lw1a_:
- d1lw1a_ is new in SCOP 1.61
- d1lw1a_ appears in SCOP 1.63
- d1lw1a_ appears in the current release, SCOPe 2.08
View in 3D
