Lineage for d1lvha_ (1lvh A:)
- Root: SCOP 1.63
Class c: Alpha and beta proteins (a/b) [51349] (117 folds) 
Fold c.108: HAD-like [56783] (1 superfamily)
3 layers: a/b/a; parallel beta-sheet of 6 strands, order 321456Superfamily c.108.1: HAD-like [56784] (10 families) 
usually contains an insertion (sub)domain after strand 1
Family c.108.1.6: beta-Phosphoglucomutase [75173] (1 protein) Protein beta-Phosphoglucomutase [75174] (1 species) Species Lactococcus lactis [TaxId:1358] [75175] (1 PDB entry) 
Domain d1lvha_: 1lvh A: [74282]
Details for d1lvha_
PDB Entry: 1lvh (more details), 2.3 Å
PDB Description: the structure of phosphorylated beta-phosphoglucomutase from lactoccocus lactis to 2.3 angstrom resolution
SCOP Domain Sequences for d1lvha_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1lvha_ c.108.1.6 (A:) beta-Phosphoglucomutase {Lactococcus lactis}
mfkavlfdldgvitdtaeyhfrawkalaeeigingvdrqfneqlkgvsredslqkildla
dkkvsaeefkelakrkndnyvkmiqdvspadvypgilqllkdlrsnkikialasaskngp
fllermnltgyfdaiadpaevaaskpapdifiaaahavgvapsesigledsqagiqaikd
sgalpigvgrpedlgddivivpdtshytleflkevwlqkqk
SCOP Domain Coordinates for d1lvha_:
Click to download the PDB-style file with coordinates for d1lvha_.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d1lvha_:
- d1lvha_ first appeared in SCOP 1.61
- d1lvha_ appears in SCOP 1.65
- d1lvha_ appears in the current release, SCOPe 2.08
View in 3D
