SCOPe 2.08: Domain d1lvha_: 1lvh A:

Lineage for d1lvha_ (1lvh A:)

1. Root: SCOPe 2.08

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.108: HAD-like [56783] (1 superfamily)
   3 layers: a/b/a; parallel beta-sheet of 6 strands, order 321456

4. Superfamily c.108.1: HAD-like [56784] (26 families)
   usually contains an insertion (sub)domain after strand 1

5. Family c.108.1.6: beta-Phosphoglucomutase-like [75173] (10 proteins)
   the insertion subdomain is a 4-helical bundle

6. Protein beta-Phosphoglucomutase [75174] (3 species)

7. Species Lactococcus lactis [TaxId:1358] [75175] (22 PDB entries)

8. Domain d1lvha_: 1lvh A: [74282]
   phosphorylated enzyme
   complexed with mg

Details for d1lvha_

PDB Entry: 1lvh, 2.3 Å

PDB Description: the structure of phosphorylated beta-phosphoglucomutase from lactoccocus lactis to 2.3 angstrom resolution

PDB Compounds: (A:) beta-phosphoglucomutase

SCOPe Domain Sequences for d1lvha_:

Sequence; same for both SEQRES and ATOM records:

>d1lvha_ c.108.1.6 (A:) beta-Phosphoglucomutase {Lactococcus lactis [TaxId: 1358]}
mfkavlfdldgvitdtaeyhfrawkalaeeigingvdrqfneqlkgvsredslqkildla
dkkvsaeefkelakrkndnyvkmiqdvspadvypgilqllkdlrsnkikialasaskngp
fllermnltgyfdaiadpaevaaskpapdifiaaahavgvapsesigledsqagiqaikd
sgalpigvgrpedlgddivivpdtshytleflkevwlqkqk

Timeline for d1lvha_:

• d1lvha_ first appeared in SCOP 1.61
  
• d1lvha_ appears in SCOPe 2.07