Lineage for d1lvaa4 (1lva A:575-634)

  1. Root: SCOP 1.65
  2. 275720Class a: All alpha proteins [46456] (179 folds)
  3. 277521Fold a.4: DNA/RNA-binding 3-helical bundle [46688] (12 superfamilies)
    core: 3-helices; bundle, closed or partly opened, right-handed twist; up-and down
  4. 277839Superfamily a.4.5: "Winged helix" DNA-binding domain [46785] (36 families) (S)
    contains a small beta-sheet (wing)
  5. 278274Family a.4.5.35: C-terminal fragment of elongation factor SelB [74683] (1 protein)
  6. 278275Protein C-terminal fragment of elongation factor SelB [74684] (1 species)
    duplication: tandem repeat of four "winged helix" domains
  7. 278276Species Moorella thermoacetica [TaxId:1525] [74685] (1 PDB entry)
  8. 278280Domain d1lvaa4: 1lva A:575-634 [74279]
    complexed with mse, so4, y1

Details for d1lvaa4

PDB Entry: 1lva (more details), 2.12 Å

PDB Description: Crystal structure of a C-terminal fragment of Moorella thermoacetica elongation factor SelB

SCOP Domain Sequences for d1lvaa4:

Sequence; same for both SEQRES and ATOM records: (download)

>d1lvaa4 a.4.5.35 (A:575-634) C-terminal fragment of elongation factor SelB {Moorella thermoacetica}
qalgeareviknlastgpfglaeardalgssrkyvlplleyldqvkftrrvgdkrvvvgn

SCOP Domain Coordinates for d1lvaa4:

Click to download the PDB-style file with coordinates for d1lvaa4.
(The format of our PDB-style files is described here.)

Timeline for d1lvaa4: