![]() | Class a: All alpha proteins [46456] (171 folds) |
![]() | Fold a.4: DNA/RNA-binding 3-helical bundle [46688] (11 superfamilies) core: 3-helices; bundle, closed or partly opened, right-handed twist; up-and down |
![]() | Superfamily a.4.5: "Winged helix" DNA-binding domain [46785] (36 families) ![]() contains a small beta-sheet (wing) |
![]() | Family a.4.5.35: C-terminal fragment of elongation factor SelB [74683] (1 protein) |
![]() | Protein C-terminal fragment of elongation factor SelB [74684] (1 species) duplication: tandem repeat of four "winged helix" domains |
![]() | Species Moorella thermoacetica [TaxId:1525] [74685] (1 PDB entry) |
![]() | Domain d1lvaa4: 1lva A:575-634 [74279] complexed with mse, so4, y1 |
PDB Entry: 1lva (more details), 2.12 Å
SCOP Domain Sequences for d1lvaa4:
Sequence; same for both SEQRES and ATOM records: (download)
>d1lvaa4 a.4.5.35 (A:575-634) C-terminal fragment of elongation factor SelB {Moorella thermoacetica} qalgeareviknlastgpfglaeardalgssrkyvlplleyldqvkftrrvgdkrvvvgn
Timeline for d1lvaa4: