Lineage for d1lvaa1 (1lva A:377-437)

  1. Root: SCOP 1.63
  2. 208553Class a: All alpha proteins [46456] (171 folds)
  3. 210246Fold a.4: DNA/RNA-binding 3-helical bundle [46688] (11 superfamilies)
    core: 3-helices; bundle, closed or partly opened, right-handed twist; up-and down
  4. 210555Superfamily a.4.5: "Winged helix" DNA-binding domain [46785] (36 families) (S)
    contains a small beta-sheet (wing)
  5. 210969Family a.4.5.35: C-terminal fragment of elongation factor SelB [74683] (1 protein)
  6. 210970Protein C-terminal fragment of elongation factor SelB [74684] (1 species)
    duplication: tandem repeat of four "winged helix" domains
  7. 210971Species Moorella thermoacetica [TaxId:1525] [74685] (1 PDB entry)
  8. 210972Domain d1lvaa1: 1lva A:377-437 [74276]

Details for d1lvaa1

PDB Entry: 1lva (more details), 2.12 Å

PDB Description: Crystal structure of a C-terminal fragment of Moorella thermoacetica elongation factor SelB

SCOP Domain Sequences for d1lvaa1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1lvaa1 a.4.5.35 (A:377-437) C-terminal fragment of elongation factor SelB {Moorella thermoacetica}
gspekilaqiiqehregldwqeaatraslsleetrkllqsmaaagqvtllrvendlyais
t

SCOP Domain Coordinates for d1lvaa1:

Click to download the PDB-style file with coordinates for d1lvaa1.
(The format of our PDB-style files is described here.)

Timeline for d1lvaa1: