SCOP 1.75: Domain d1luzb_: 1luz B:

Lineage for d1luzb_ (1luz B:)

1. Root: SCOP 1.75

2. Class b: All beta proteins [48724] (174 folds)

3. Fold b.40: OB-fold [50198] (16 superfamilies)
   barrel, closed or partly opened n=5, S=10 or S=8; greek-key

4. Superfamily b.40.4: Nucleic acid-binding proteins [50249] (16 families)

5. Family b.40.4.5: Cold shock DNA-binding domain-like [50282] (30 proteins)
   barrel, closed; n=5, S=8

6. Protein Viral structural mimic of eIF2alpha [74952] (2 species)

7. Species Vaccinia virus [TaxId:10245] [74953] (1 PDB entry)

8. Domain d1luzb_: 1luz B: [74272]
   complexed with mse

Details for d1luzb_

PDB Entry: 1luz, 1.8 Å

PDB Description: Crystal Structure of the K3L Protein From Vaccinia Virus (Wisconsin Strain)

PDB Compounds: (B:) Protein K3

SCOP Domain Sequences for d1luzb_:

Sequence; same for both SEQRES and ATOM records:

>d1luzb_ b.40.4.5 (B:) Viral structural mimic of eIF2alpha {Vaccinia virus [TaxId: 10245]}
yslpnagdvikgrvyekdyalyiylfdyphfeailaesvkmhmdryveyrdklvgktvkv
kvirvdytkgyidvnykrmcrhq

Timeline for d1luzb_:

• d1luzb_ first appeared in SCOP 1.61
  
• d1luzb_ appears in SCOP 1.73
  
• d1luzb_ appears in SCOPe 2.01
  
• d1luzb_ appears in the current release, SCOPe 2.08