| Class b: All beta proteins [48724] (141 folds) |
| Fold b.40: OB-fold [50198] (10 superfamilies) barrel, closed or partly opened n=5, S=10 or S=8; greek-key |
Superfamily b.40.4: Nucleic acid-binding proteins [50249] (12 families) ![]() |
| Family b.40.4.5: Cold shock DNA-binding domain-like [50282] (17 proteins) barrel, closed; n=5, S=8 |
| Protein Viral structural mimic of eIF2alpha [74952] (2 species) |
| Species Vaccinia virus [TaxId:10245] [74953] (1 PDB entry) |
| Domain d1luzb_: 1luz B: [74272] complexed with mse |
PDB Entry: 1luz (more details), 1.8 Å
SCOP Domain Sequences for d1luzb_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1luzb_ b.40.4.5 (B:) Viral structural mimic of eIF2alpha {Vaccinia virus}
yslpnagdvikgrvyekdyalyiylfdyphfeailaesvkmhmdryveyrdklvgktvkv
kvirvdytkgyidvnykrmcrhq
Timeline for d1luzb_: