Lineage for d1luza_ (1luz A:)

  1. Root: SCOPe 2.07
  2. 2344607Class b: All beta proteins [48724] (178 folds)
  3. 2381452Fold b.40: OB-fold [50198] (17 superfamilies)
    barrel, closed or partly opened n=5, S=10 or S=8; greek-key
  4. 2382744Superfamily b.40.4: Nucleic acid-binding proteins [50249] (18 families) (S)
  5. 2383132Family b.40.4.5: Cold shock DNA-binding domain-like [50282] (32 protein domains)
    barrel, closed; n=5, S=8
  6. 2383604Protein Viral structural mimic of eIF2alpha [74952] (2 species)
  7. 2383607Species Vaccinia virus [TaxId:10245] [74953] (1 PDB entry)
  8. 2383608Domain d1luza_: 1luz A: [74271]

Details for d1luza_

PDB Entry: 1luz (more details), 1.8 Å

PDB Description: Crystal Structure of the K3L Protein From Vaccinia Virus (Wisconsin Strain)
PDB Compounds: (A:) Protein K3

SCOPe Domain Sequences for d1luza_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1luza_ b.40.4.5 (A:) Viral structural mimic of eIF2alpha {Vaccinia virus [TaxId: 10245]}
fcyslpnagdvikgrvyekdyalyiylfdyphfeailaesvkmhmdryveyrdklvgktv
kvkvirvdytkgyidvnykrmcrhq

SCOPe Domain Coordinates for d1luza_:

Click to download the PDB-style file with coordinates for d1luza_.
(The format of our PDB-style files is described here.)

Timeline for d1luza_:

View in 3D
Domains from other chains:
(mouse over for more information)
d1luzb_