SCOPe 2.04: Domain d1luwa2: 1luw A:84-198

Lineage for d1luwa2 (1luw A:84-198)

1. Root: SCOPe 2.04

2. Class d: Alpha and beta proteins (a+b) [53931] (380 folds)

3. Fold d.44: Fe,Mn superoxide dismutase (SOD), C-terminal domain [54718] (1 superfamily)
   alpha-beta(2)-alpha-beta-alpha(2); 3 strands of antiparallel sheet: 213

4. Superfamily d.44.1: Fe,Mn superoxide dismutase (SOD), C-terminal domain [54719] (2 families)
   automatically mapped to Pfam PF02777

5. Family d.44.1.1: Fe,Mn superoxide dismutase (SOD), C-terminal domain [54720] (4 proteins)

6. Protein Mn superoxide dismutase (MnSOD) [54721] (9 species)

7. Species Human (Homo sapiens) [TaxId:9606] [54724] (26 PDB entries)

8. Domain d1luwa2: 1luw A:84-198 [74268]
   Other proteins in same PDB: d1luwa1, d1luwb1
   complexed with mn, so4

Details for d1luwa2

PDB Entry: 1luw, 2.3 Å

PDB Description: catalytic and structural effects of amino-acid substitution at his 30 in human manganese superoxide dismutase: insertion of val cgamma into the substrate access channel

PDB Compounds: (A:) Superoxide dismutase [Mn]

SCOPe Domain Sequences for d1luwa2:

Sequence; same for both SEQRES and ATOM records:

>d1luwa2 d.44.1.1 (A:84-198) Mn superoxide dismutase (MnSOD) {Human (Homo sapiens) [TaxId: 9606]}
ngggepkgelleaikrdfgsfdkfkekltaasvgvqgsgwgwlgfnkerghlqiaacpnq
dplqgttglipllgidvwehayylqyknvrpdylkaiwnvinwenvterymackk

Timeline for d1luwa2:

• d1luwa2 first appeared in SCOP 1.61
  
• d1luwa2 appears in SCOPe 2.03
  
• d1luwa2 appears in SCOPe 2.05
  
• d1luwa2 appears in the current release, SCOPe 2.08