Lineage for d1luwa2 (1luw A:84-198)

  1. Root: SCOP 1.75
  2. 849709Class d: Alpha and beta proteins (a+b) [53931] (376 folds)
  3. 859482Fold d.44: Fe,Mn superoxide dismutase (SOD), C-terminal domain [54718] (1 superfamily)
    alpha-beta(2)-alpha-beta-alpha(2); 3 strands of antiparallel sheet: 213
  4. 859483Superfamily d.44.1: Fe,Mn superoxide dismutase (SOD), C-terminal domain [54719] (1 family) (S)
  5. 859484Family d.44.1.1: Fe,Mn superoxide dismutase (SOD), C-terminal domain [54720] (3 proteins)
  6. 859610Protein Mn superoxide dismutase (MnSOD) [54721] (7 species)
  7. 859663Species Human (Homo sapiens) [TaxId:9606] [54724] (27 PDB entries)
  8. 859720Domain d1luwa2: 1luw A:84-198 [74268]
    Other proteins in same PDB: d1luwa1, d1luwb1

Details for d1luwa2

PDB Entry: 1luw (more details), 2.3 Å

PDB Description: catalytic and structural effects of amino-acid substitution at his 30 in human manganese superoxide dismutase: insertion of val cgamma into the substrate access channel
PDB Compounds: (A:) Superoxide dismutase [Mn]

SCOP Domain Sequences for d1luwa2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1luwa2 d.44.1.1 (A:84-198) Mn superoxide dismutase (MnSOD) {Human (Homo sapiens) [TaxId: 9606]}
ngggepkgelleaikrdfgsfdkfkekltaasvgvqgsgwgwlgfnkerghlqiaacpnq
dplqgttglipllgidvwehayylqyknvrpdylkaiwnvinwenvterymackk

SCOP Domain Coordinates for d1luwa2:

Click to download the PDB-style file with coordinates for d1luwa2.
(The format of our PDB-style files is described here.)

Timeline for d1luwa2:

View in 3D
Domains from same chain:
(mouse over for more information)
d1luwa1