Lineage for d1lssd_ (1lss D:)
- Root: SCOP 1.61
Class c: Alpha and beta proteins (a/b) [51349] (117 folds) 
Fold c.2: NAD(P)-binding Rossmann-fold domains [51734] (1 superfamily) Superfamily c.2.1: NAD(P)-binding Rossmann-fold domains [51735] (11 families) 
Family c.2.1.9: Potassium channel NAD-binding domain [63944] (4 proteins) 
Protein Ktn Mja218 [75120] (1 species) Species Archaeon Methanococcus jannaschii [TaxId:2190] [75121] (1 PDB entry) 
Domain d1lssd_: 1lss D: [74249]
Details for d1lssd_
PDB Entry: 1lss (more details), 2.3 Å
PDB Description: ktn mja218 crystal structure in complex with nad+
SCOP Domain Sequences for d1lssd_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1lssd_ c.2.1.9 (D:) Ktn Mja218 {Archaeon Methanococcus jannaschii}
myiiiagigrvgytlakslsekghdivlididkdickkasaeidalvingdctkiktled
agiedadmyiavtgkeevnlmssllaksyginktiariseieykdvferlgvdvvvspel
iaanyieklier
SCOP Domain Coordinates for d1lssd_:
Click to download the PDB-style file with coordinates for d1lssd_.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d1lssd_:
- d1lssd_ is new in SCOP 1.61
- d1lssd_ appears in SCOP 1.63
- d1lssd_ appears in the current release, SCOPe 2.08
View in 3D
