Lineage for d1lssb_ (1lss B:)

  1. Root: SCOP 1.63
  2. 235644Class c: Alpha and beta proteins (a/b) [51349] (117 folds)
  3. 238223Fold c.2: NAD(P)-binding Rossmann-fold domains [51734] (1 superfamily)
    core: 3 layers, a/b/a; parallel beta-sheet of 6 strands, order 321456
    The nucleotide-binding modes of this and the next two folds/superfamilies are similar
  4. 238224Superfamily c.2.1: NAD(P)-binding Rossmann-fold domains [51735] (10 families) (S)
  5. 239470Family c.2.1.9: Potassium channel NAD-binding domain [63944] (4 proteins)
  6. 239475Protein Ktn Mja218 [75120] (1 species)
  7. 239476Species Archaeon Methanococcus jannaschii [TaxId:2190] [75121] (1 PDB entry)
  8. 239478Domain d1lssb_: 1lss B: [74247]

Details for d1lssb_

PDB Entry: 1lss (more details), 2.3 Å

PDB Description: ktn mja218 crystal structure in complex with nad+

SCOP Domain Sequences for d1lssb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1lssb_ c.2.1.9 (B:) Ktn Mja218 {Archaeon Methanococcus jannaschii}
myiiiagigrvgytlakslsekghdivlididkdickkasaeidalvingdctkiktled
agiedadmyiavtgkeevnlmssllaksyginktiariseieykdvferlgvdvvvspel
iaanyieklier

SCOP Domain Coordinates for d1lssb_:

Click to download the PDB-style file with coordinates for d1lssb_.
(The format of our PDB-style files is described here.)

Timeline for d1lssb_: