![]() | Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
![]() | Fold c.2: NAD(P)-binding Rossmann-fold domains [51734] (1 superfamily) core: 3 layers, a/b/a; parallel beta-sheet of 6 strands, order 321456 The nucleotide-binding modes of this and the next two folds/superfamilies are similar |
![]() | Superfamily c.2.1: NAD(P)-binding Rossmann-fold domains [51735] (13 families) ![]() |
![]() | Family c.2.1.9: Potassium channel NAD-binding domain [63944] (5 proteins) automatically mapped to Pfam PF02254 |
![]() | Protein Ktn Mja218 [75120] (1 species) |
![]() | Species Methanococcus jannaschii [TaxId:2190] [75121] (1 PDB entry) |
![]() | Domain d1lssb_: 1lss B: [74247] complexed with nad |
PDB Entry: 1lss (more details), 2.3 Å
SCOPe Domain Sequences for d1lssb_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1lssb_ c.2.1.9 (B:) Ktn Mja218 {Methanococcus jannaschii [TaxId: 2190]} myiiiagigrvgytlakslsekghdivlididkdickkasaeidalvingdctkiktled agiedadmyiavtgkeevnlmssllaksyginktiariseieykdvferlgvdvvvspel iaanyieklier
Timeline for d1lssb_: