Lineage for d1lssb_ (1lss B:)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2841004Fold c.2: NAD(P)-binding Rossmann-fold domains [51734] (1 superfamily)
    core: 3 layers, a/b/a; parallel beta-sheet of 6 strands, order 321456
    The nucleotide-binding modes of this and the next two folds/superfamilies are similar
  4. 2841005Superfamily c.2.1: NAD(P)-binding Rossmann-fold domains [51735] (13 families) (S)
  5. 2845624Family c.2.1.9: Potassium channel NAD-binding domain [63944] (5 proteins)
    automatically mapped to Pfam PF02254
  6. 2845641Protein Ktn Mja218 [75120] (1 species)
  7. 2845642Species Methanococcus jannaschii [TaxId:2190] [75121] (1 PDB entry)
  8. 2845644Domain d1lssb_: 1lss B: [74247]
    complexed with nad

Details for d1lssb_

PDB Entry: 1lss (more details), 2.3 Å

PDB Description: ktn mja218 crystal structure in complex with nad+
PDB Compounds: (B:) Trk system potassium uptake protein trkA homolog

SCOPe Domain Sequences for d1lssb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1lssb_ c.2.1.9 (B:) Ktn Mja218 {Methanococcus jannaschii [TaxId: 2190]}
myiiiagigrvgytlakslsekghdivlididkdickkasaeidalvingdctkiktled
agiedadmyiavtgkeevnlmssllaksyginktiariseieykdvferlgvdvvvspel
iaanyieklier

SCOPe Domain Coordinates for d1lssb_:

Click to download the PDB-style file with coordinates for d1lssb_.
(The format of our PDB-style files is described here.)

Timeline for d1lssb_: