SCOP 1.63: Domain d1lssa_: 1lss A:

Lineage for d1lssa_ (1lss A:)

1. Root: SCOP 1.63

2. Class c: Alpha and beta proteins (a/b) [51349] (117 folds)

3. Fold c.2: NAD(P)-binding Rossmann-fold domains [51734] (1 superfamily)
   core: 3 layers, a/b/a; parallel beta-sheet of 6 strands, order 321456
   The nucleotide-binding modes of this and the next two folds/superfamilies are similar

4. Superfamily c.2.1: NAD(P)-binding Rossmann-fold domains [51735] (10 families)

5. Family c.2.1.9: Potassium channel NAD-binding domain [63944] (4 proteins)

6. Protein Ktn Mja218 [75120] (1 species)

7. Species Archaeon Methanococcus jannaschii [TaxId:2190] [75121] (1 PDB entry)

8. Domain d1lssa_: 1lss A: [74246]

Details for d1lssa_

PDB Entry: 1lss, 2.3 Å

PDB Description: ktn mja218 crystal structure in complex with nad+

SCOP Domain Sequences for d1lssa_:

Sequence; same for both SEQRES and ATOM records:

>d1lssa_ c.2.1.9 (A:) Ktn Mja218 {Archaeon Methanococcus jannaschii}
myiiiagigrvgytlakslsekghdivlididkdickkasaeidalvingdctkiktled
agiedadmyiavtgkeevnlmssllaksyginktiariseieykdvferlgvdvvvspel
iaanyieklier

Timeline for d1lssa_:

• d1lssa_ first appeared in SCOP 1.61
  
• d1lssa_ appears in SCOP 1.65
  
• d1lssa_ appears in the current release, SCOPe 2.08