Lineage for d1lshb_ (1lsh B:)

  1. Root: SCOPe 2.05
  2. 1955192Class f: Membrane and cell surface proteins and peptides [56835] (57 folds)
  3. 1956161Fold f.7: Lipovitellin-phosvitin complex; beta-sheet shell regions [56967] (1 superfamily)
    contains several large open beta-sheets
  4. 1956162Superfamily f.7.1: Lipovitellin-phosvitin complex; beta-sheet shell regions [56968] (1 family) (S)
  5. 1956163Family f.7.1.1: Lipovitellin-phosvitin complex; beta-sheet shell regions [56969] (1 protein)
  6. 1956164Protein Lipovitellin-phosvitin complex; beta-sheet shell regions [56970] (1 species)
  7. 1956165Species Lamprey (Ichthyomyzon unicuspis) [TaxId:30308] [56971] (1 PDB entry)
  8. 1956168Domain d1lshb_: 1lsh B: [74245]
    Other proteins in same PDB: d1lsha1
    complexed with pld, upl

Details for d1lshb_

PDB Entry: 1lsh (more details), 1.9 Å

PDB Description: lipid-protein interactions in lipovitellin
PDB Compounds: (B:) lipovitellin (lv-2)

SCOPe Domain Sequences for d1lshb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1lshb_ f.7.1.1 (B:) Lipovitellin-phosvitin complex; beta-sheet shell regions {Lamprey (Ichthyomyzon unicuspis) [TaxId: 30308]}
skpkvvivlravradgkqqglqttlyygltsnglpkakivavelsdlsvwklcakfrlsa
hmkakaaigwgkncqqyramleastgnlqshpaarvdikwgrlpsslqraknallengap
viasklemeimpkanqkhqvsvilaamtprrmniivklpkvtyfqqgillpftf

SCOPe Domain Coordinates for d1lshb_:

Click to download the PDB-style file with coordinates for d1lshb_.
(The format of our PDB-style files is described here.)

Timeline for d1lshb_: