![]() | Class f: Membrane and cell surface proteins and peptides [56835] (58 folds) |
![]() | Fold f.7: Lipovitellin-phosvitin complex; beta-sheet shell regions [56967] (1 superfamily) contains several large open beta-sheets |
![]() | Superfamily f.7.1: Lipovitellin-phosvitin complex; beta-sheet shell regions [56968] (1 family) ![]() |
![]() | Family f.7.1.1: Lipovitellin-phosvitin complex; beta-sheet shell regions [56969] (1 protein) |
![]() | Protein Lipovitellin-phosvitin complex; beta-sheet shell regions [56970] (1 species) |
![]() | Species Lamprey (Ichthyomyzon unicuspis) [TaxId:30308] [56971] (1 PDB entry) |
![]() | Domain d1lsha2: 1lsh A:17-284 [74243] Other proteins in same PDB: d1lsha1 |
PDB Entry: 1lsh (more details), 1.9 Å
SCOP Domain Sequences for d1lsha2:
Sequence; same for both SEQRES and ATOM records: (download)
>d1lsha2 f.7.1.1 (A:17-284) Lipovitellin-phosvitin complex; beta-sheet shell regions {Lamprey (Ichthyomyzon unicuspis) [TaxId: 30308]} efqpgkvyrysydafsisglpepgvnraglsgemkieihghthnqatlkitqvnlkyflg pwpsdsfypltggydhfiqqlevpvrfdysagrigdiyappqvtdtavnivrgilnlfql slkknqqtfelqetgvegicqttyvvqegyrtnemavvktkdlnncdhkvyktmgtayae rcptcqkmnknlrstavynyaifdepsgyiiksahseeiqqlsvfdikegnvviesrqkl ilegiqsapaasqaaslqnrgglmykfp
Timeline for d1lsha2: