Lineage for d1lsha1 (1lsh A:285-620)

  1. Root: SCOPe 2.06
  2. 1976409Class a: All alpha proteins [46456] (289 folds)
  3. 2006336Fold a.118: alpha-alpha superhelix [48370] (25 superfamilies)
    multihelical; 2 (curved) layers: alpha/alpha; right-handed superhelix
  4. 2007062Superfamily a.118.4: Lipovitellin-phosvitin complex, superhelical domain [48431] (1 family) (S)
  5. 2007063Family a.118.4.1: Lipovitellin-phosvitin complex, superhelical domain [48432] (1 protein)
  6. 2007064Protein Lipovitellin-phosvitin complex, superhelical domain [48433] (1 species)
  7. 2007065Species Lamprey (Ichthyomyzon unicuspis) [TaxId:30308] [48434] (1 PDB entry)
  8. 2007066Domain d1lsha1: 1lsh A:285-620 [74242]
    Other proteins in same PDB: d1lsha2, d1lsha3, d1lshb_
    complexed with pld, upl

Details for d1lsha1

PDB Entry: 1lsh (more details), 1.9 Å

PDB Description: lipid-protein interactions in lipovitellin
PDB Compounds: (A:) lipovitellin (lv-1n, lv-1c)

SCOPe Domain Sequences for d1lsha1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1lsha1 a.118.4.1 (A:285-620) Lipovitellin-phosvitin complex, superhelical domain {Lamprey (Ichthyomyzon unicuspis) [TaxId: 30308]}
ssaitkmsslfvtkgknleseihtvlkhlvennqlsvhedapakflrltaflrnvdagvl
qsiwhklhqqkdyrrwildavpamatseallflkrtlaseqltsaeatqivastlsnqqa
treslsyarellntsfirnrpilrktavlgygslvfrycantvscpdellqplhdllsqs
sdrakeeeivlalkalgnagqpnsikkiqrflpgqgksldeystrvqaeaimalrniakr
dprkvqeivlpiflnvaikselrirscivffeskpsvalvsmvavrlrrepnlqvasfvy
sqmrslsrssnpefrdvaaacsvaikmlgskldrlg

SCOPe Domain Coordinates for d1lsha1:

Click to download the PDB-style file with coordinates for d1lsha1.
(The format of our PDB-style files is described here.)

Timeline for d1lsha1:

View in 3D
Domains from other chains:
(mouse over for more information)
d1lshb_